PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_34009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 76aa    MW: 8853.32 Da    PI: 10.5424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_34009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM821.2e-2525673128
         NAM  73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 r+nrat++gyWk+tgkdke+++  g lvg+kktLvfykgrapkgekt+Wvmheyrl
  PEQU_34009   2 RTNRATNAGYWKTTGKDKEIFH-YGVLVGMKKTLVFYKGRAPKGEKTSWVMHEYRL 56 
                 89********************.999*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.374174IPR003441NAC domain
SuperFamilySSF1019411.26E-26265IPR003441NAC domain
PfamPF023651.1E-12356IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MRTNRATNAG YWKTTGKDKE IFHYGVLVGM KKTLVFYKGR APKGEKTSWV MHEYRLQTDF  60
PYKSSKVLIL LSYLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-1825691145NAC domain-containing protein 19
3swp_C2e-1825691145NAC domain-containing protein 19
3swp_B2e-1825691145NAC domain-containing protein 19
3swp_A2e-1825691145NAC domain-containing protein 19
3swm_D2e-1825691145NAC domain-containing protein 19
3swm_C2e-1825691145NAC domain-containing protein 19
3swm_B2e-1825691145NAC domain-containing protein 19
3swm_A2e-1825691145NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916375.12e-37PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ28e-28NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A060CXK93e-35A0A060CXK9_MAIZE; NAC transcription factor (Fragment)
STRINGGRMZM2G031120_P019e-35(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-33NAC domain containing protein 58